PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C020699P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 274aa    MW: 31234.3 Da    PI: 6.1705
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C020699P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding521.6e-162471148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT eEd ll+++++ +G g+W+  a+  g++Rt+k+c++rw++yl
   MELO3C020699P1 24 RGPWTIEEDTLLIRYIAGHGEGQWNILAKQAGLKRTGKSCRLRWLNYL 71
                     89********************************************97 PP

2Myb_DNA-binding50.16.4e-1677120146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T +E++l+++++ ++G++ W++Ia++++ gRt++++k++w++
   MELO3C020699P1  77 RGNLTLQEQLLILELHSKWGNR-WSKIAQHLP-GRTDNEIKNYWRT 120
                      7899******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.7251971IPR017930Myb domain
SuperFamilySSF466893.63E-3022118IPR009057Homeodomain-like
SMARTSM007173.6E-132373IPR001005SANT/Myb domain
PfamPF002492.0E-152471IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-222578IPR009057Homeodomain-like
CDDcd001671.14E-92671No hitNo description
PROSITE profilePS5129424.5872126IPR017930Myb domain
SMARTSM007172.2E-1476124IPR001005SANT/Myb domain
PfamPF002498.1E-1577120IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-2379126IPR009057Homeodomain-like
CDDcd001672.56E-792120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 274 aa     Download sequence    Send to blast
MANLSTKSEN YKNANEEEIS ELRRGPWTIE EDTLLIRYIA GHGEGQWNIL AKQAGLKRTG  60
KSCRLRWLNY LKPDVKRGNL TLQEQLLILE LHSKWGNRWS KIAQHLPGRT DNEIKNYWRT  120
RVQKQLRQLK VEANSKRFLD AIHHLSMLEA MDQSSNFSLN FPPPSALQNT TSPNSFETAI  180
HPFNDHGGGA PLRAPCSASQ WPDISQPPPS SCGEFGEAWR LNMVEMQKQK QEPVCSLGAW  240
EIEDCDVPMA APDWLMEDSM VENLWSLEDQ NLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-26191262108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819260.0LN681926.1 Cucumis melo genomic scaffold, anchoredscaffold00044.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008457536.10.0PREDICTED: myb-related protein 305-like
SwissprotQ9LK952e-62MYB21_ARATH; Transcription factor MYB21
TrEMBLM5XYM82e-83M5XYM8_PRUPE; Uncharacterized protein
STRINGSolyc05g009230.1.18e-77(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2458633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.12e-62myb domain protein 62